RPS18 Peptide - C-terminal region
RPS18 Peptide - C-terminal region
Product Specifications
Product Name Alternative
D6S218E, HKE3, KE-3, KE3, S18
UniProt
P62269
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RPS18 Rabbit Polyclonal Antibody (orb587926) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_072045
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQHTKTTGRRGRTVGVSK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
abx710020-01 100 mL
Medium for Rabbit Cardiac Microvascular Endothelial Cells (CMEC)
Sign In for Pricing
View Details abx710020-02 500 mL
Medium for Rabbit Cardiac Microvascular Endothelial Cells (CMEC)
Sign In for Pricing
View Details abx710020-03 1 L
Medium for Rabbit Cardiac Microvascular Endothelial Cells (CMEC)
Sign In for Pricing
View Details 