Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS18 Peptide - C-terminal region

RPS18 Peptide - C-terminal region

Product Specifications

Product Name Alternative

D6S218E, HKE3, KE-3, KE3, S18

UniProt

P62269

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPS18 Rabbit Polyclonal Antibody (orb587926) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_072045

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQHTKTTGRRGRTVGVSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRODH (NM_016335) Human Over-expression Lysate
LH10037V 100 µg

PRODH (NM_016335) Human Over-expression Lysate

Sign In for Pricing
View Details
BO-264 1mg
A22318-1 1 mg

BO-264 1mg

Sign In for Pricing
View Details
Human Semaphorin-3C (SEMA3C) ELISA Kit
orb1669245-01 48 Tests

Human Semaphorin-3C (SEMA3C) ELISA Kit

Sign In for Pricing
View Details
Human Semaphorin-3C (SEMA3C) ELISA Kit
orb1669245-02 96 Tests

Human Semaphorin-3C (SEMA3C) ELISA Kit

Sign In for Pricing
View Details
Ttc32 ORF Vector (Mouse) (pORF)
48688014 1.0 µg DNA

Ttc32 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Rat Monoclonal NMDA R, NR1 Subunit Antibody (1031915) [DyLight 350]
FAB10655D 0.1 mL

Rat Monoclonal NMDA R, NR1 Subunit Antibody (1031915) [DyLight 350]

Sign In for Pricing
View Details