Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXC13 Peptide - middle region

HOXC13 Peptide - middle region

Product Specifications

Product Name Alternative

HOX3, HOX3G

UniProt

P31276

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HOXC13 Rabbit Polyclonal Antibody (orb587943) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_059106

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QQKPCAYHPGDKYPEPSGALPGDDLSSRAKEFAFYPSFASSYQAMPGYLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL
BNC401073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human ACP5/TRAP Protein (His Tag)
PKSH031534 20 µg

Recombinant Human ACP5/TRAP Protein (His Tag)

Sign In for Pricing
View Details
4-Hydroxy-Exatecan Mesylate
TRC-H399180-25MG 25 mg

4-Hydroxy-Exatecan Mesylate

Sign In for Pricing
View Details
LDN 193189 Hydrochloride
TRC-P480133-50MG 50 mg

LDN 193189 Hydrochloride

Sign In for Pricing
View Details
Ephrin A1 (EFNA1) (NM_004428) Human Recombinant Protein
TP310635 20 µg

Ephrin A1 (EFNA1) (NM_004428) Human Recombinant Protein

Sign In for Pricing
View Details
POU4F3 (NM_002700) Human Over-expression Lysate
LC400949 20 µg

POU4F3 (NM_002700) Human Over-expression Lysate

Sign In for Pricing
View Details