Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXC13 Peptide - middle region

HOXC13 Peptide - middle region

Product Specifications

Product Name Alternative

HOX3, HOX3G

UniProt

P31276

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HOXC13 Rabbit Polyclonal Antibody (orb587943) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_059106

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QQKPCAYHPGDKYPEPSGALPGDDLSSRAKEFAFYPSFASSYQAMPGYLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL6 Antibody (Biotin)
KB-9272-01 50 μL

IL6 Antibody (Biotin)

Sign In for Pricing
View Details
IL6 Antibody (Biotin)
KB-9272-02 100 µL

IL6 Antibody (Biotin)

Sign In for Pricing
View Details
IL6 Antibody (Biotin)
KB-9272-03 1 mL

IL6 Antibody (Biotin)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary: left
CB602439 1 Block

Frozen Tissue Blocks, Ovary: left

Sign In for Pricing
View Details
Cytokeratin 5+6 Rabbit Polyclonal Antibody
ER1901-03 100 µL

Cytokeratin 5+6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AOC2 (NM_009590) Human Recombinant Protein
TP322991 20 µg

AOC2 (NM_009590) Human Recombinant Protein

Sign In for Pricing
View Details