CACNB3 Peptide - C-terminal region
CACNB3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CAB3, CACNLB3
UniProt
P54284
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CACNB3 Rabbit Polyclonal Antibody (orb587970) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001193846
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHNHSDRNWQRNRPWPKDS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB0348-100 1x 100 µL
Histiocytoma Marker (D11), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472306-100 1x 100 µL
MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (rMMP3/1730), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
RD-S100A10-Mu-01 96 Tests
Mouse S100 Calcium Binding Protein A10 (S100A10) ELISA Kit
Sign In for Pricing
View Details RD-S100A10-Mu-02 48 Tests
Mouse S100 Calcium Binding Protein A10 (S100A10) ELISA Kit
Sign In for Pricing
View Details