Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CACNB3 Peptide - C-terminal region

CACNB3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CAB3, CACNLB3

UniProt

P54284

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CACNB3 Rabbit Polyclonal Antibody (orb587970) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001193846

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHNHSDRNWQRNRPWPKDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HELT (NM_001300782) Human Tagged ORF Clone
RG236862 10 µg

HELT (NM_001300782) Human Tagged ORF Clone

Sign In for Pricing
View Details
RAG1 Antibody
OC-261-01 50 μL

RAG1 Antibody

Sign In for Pricing
View Details
RAG1 Antibody
OC-261-02 100 µL

RAG1 Antibody

Sign In for Pricing
View Details
RAG1 Antibody
OC-261-03 1 mL

RAG1 Antibody

Sign In for Pricing
View Details
APOL2 Antibody
8C14540-AAT 50 µg

APOL2 Antibody

Sign In for Pricing
View Details
GPR85 Antibody
8G357-AAT 50 µg

GPR85 Antibody

Sign In for Pricing
View Details