Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GEMIN7 Peptide - N-terminal region

GEMIN7 Peptide - N-terminal region

Product Specifications

UniProt

Q9H840

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GEMIN7 Rabbit Polyclonal Antibody (orb587979) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001007270

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MQTPVNIPVPVLRLPRGPDGFSRGFAPDGRRAPLRPEVPEIQECPIAQES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Ovary: right
CS807886 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details
Arhgap9 Mouse Gene Knockout Kit (CRISPR)
KN501518 1 Kit

Arhgap9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1-(2-Amino-5-hydroxyphenyl)ethanone
TRC-A578283-10MG 10 mg

1-(2-Amino-5-hydroxyphenyl)ethanone

Sign In for Pricing
View Details
Recombinant Human EphB2 Protein (aa 570-987, His &GST Tag)
PKSH030383 50 µg

Recombinant Human EphB2 Protein (aa 570-987, His &GST Tag)

Sign In for Pricing
View Details
C19orf80 (ANGPTL8) Human Gene Knockout Kit (CRISPR)
KN418000 1 Kit

C19orf80 (ANGPTL8) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Pvalb Guinea Pig Polyclonal Antibody
24428 100 µL

Pvalb Guinea Pig Polyclonal Antibody

Sign In for Pricing
View Details