Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GEMIN7 Peptide - N-terminal region

GEMIN7 Peptide - N-terminal region

Product Specifications

UniProt

Q9H840

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GEMIN7 Rabbit Polyclonal Antibody (orb587979) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001007270

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MQTPVNIPVPVLRLPRGPDGFSRGFAPDGRRAPLRPEVPEIQECPIAQES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCIN Rabbit Monoclonal Antibody [Clone ID: R07-6G2]
TA385215 100 µL

SCIN Rabbit Monoclonal Antibody [Clone ID: R07-6G2]

Sign In for Pricing
View Details
N-(2-Hydroxyethyl)nicotinamide
TRC-H942365-5G 5 g

N-(2-Hydroxyethyl)nicotinamide

Sign In for Pricing
View Details
7-(Diethylamino)coumarin-3-carbonyl Azide
TRC-D473728-50MG 50 mg

7-(Diethylamino)coumarin-3-carbonyl Azide

Sign In for Pricing
View Details
PGA
AB0197-200 600 µg

PGA

Sign In for Pricing
View Details
4-Hydroxybenzenesulfonic Acid Ammonium Salt
TRC-H807815-50G 50 g

4-Hydroxybenzenesulfonic Acid Ammonium Salt

Sign In for Pricing
View Details
TentaGel® B Boc / NH₂
B30132.12.5G 5 g

TentaGel® B Boc / NH₂

Sign In for Pricing
View Details