POLR1C Peptide - N-terminal region
POLR1C Peptide - N-terminal region
Product Specifications
UniProt
H0Y723
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with POLR1C Rabbit Polyclonal Antibody (orb587999) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENSLEFDMVGIDA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Purified Anti-Mouse CD73 Antibody[TY/23]](https://cdn.genprice.uk/products/763/68dd14c4061270361e7d7127/imageurl08/e-ab-f1089a.webp)
