POLR1C Peptide - N-terminal region
POLR1C Peptide - N-terminal region
Product Specifications
UniProt
H0Y723
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with POLR1C Rabbit Polyclonal Antibody (orb587999) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENSLEFDMVGIDA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC420621 20 µg
TIP30 (HTATIP2) (NM_001098523) Human Over-expression Lysate
Sign In for Pricing
View Details 
LC401876 20 µg
RPB11 (POLR2J) (NM_006234) Human Over-expression Lysate
Sign In for Pricing
View Details 
E-UNEL-MK0011-01 5x 96 Tests
Uncoated Monkey FE (Ferritin) ELISA Kit
Sign In for Pricing
View Details E-UNEL-MK0011-02 15x 96 Tests
Uncoated Monkey FE (Ferritin) ELISA Kit
Sign In for Pricing
View Details ![Myosin Light Chain 2 (MYL2) Mouse Monoclonal Antibody [Clone ID: 7C9]](https://cdn.genprice.uk/products/937/68dd189a061270361e8fbd5f/imageurl/am06318su-n.webp)
AM06318SU-N 100 µL
Myosin Light Chain 2 (MYL2) Mouse Monoclonal Antibody [Clone ID: 7C9]
Sign In for Pricing
View Details 