FAM91A1 Peptide - C-terminal region
FAM91A1 Peptide - C-terminal region
Product Specifications
UniProt
E7ER68
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FAM91A1 Rabbit Polyclonal Antibody (orb588024) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HLCGYVTMLNASSQLADRKLSDASDERGEPDLASGSDVNGSTESFEMVIE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470994-100 1x 100 µL
TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940630-100 1x 100 µL
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741037-100 1x 100 µL
CD44 Standard (DF1485), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC551037-100 1x 100 µL
CD44 Standard (DF1485), CF555 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400419-100 1x 100 µL
Transglutaminase II (TGM2/419), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details