Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KBTBD11 Peptide - middle region

KBTBD11 Peptide - middle region

Product Specifications

Product Name Alternative

KLHDC7C

UniProt

O94819

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KBTBD11 Rabbit Polyclonal Antibody (orb588025) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055682

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGPAGERAGSRPQSPSGDADARGDAAVYCFHAAAGEWRELTRLPEGAPAR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSX8 sgRNA CRISPR Lentivector set (Human)
K2292601 3x 1.0 µg

SSX8 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Human RBC Ab
MBS122162-01 0.1 mg

Human RBC Ab

Sign In for Pricing
View Details
Human RBC Ab
MBS122162-02 1 mg

Human RBC Ab

Sign In for Pricing
View Details
Human RBC Ab
MBS122162-03 5x 1 mg

Human RBC Ab

Sign In for Pricing
View Details
BRMS1 Rabbit Polyclonal Antibody (Cy5.5)
orb1013845 100 µL

BRMS1 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
P16 (2D9A) Antibody
252702 0.1 mL

P16 (2D9A) Antibody

Sign In for Pricing
View Details