Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARMC1 Peptide - C-terminal region

ARMC1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Arcp

UniProt

Q9NVT9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARMC1 Rabbit Polyclonal Antibody (orb588031) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060590

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VEQNTELPDYLPEDESPTKEQDKAVSRVGSHPEGGASWLSTAANFLSRSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tara Double Nickase Plasmid (h)
sc-409137-NIC 20 µg

Tara Double Nickase Plasmid (h)

Sign In for Pricing
View Details
TBCK sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2810406 1.0 µg DNA

TBCK sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
RBM5 Polyclonal Antibody
E-AB-15336-01 20 µL

RBM5 Polyclonal Antibody

Sign In for Pricing
View Details
RBM5 Polyclonal Antibody
E-AB-15336-02 60 µL

RBM5 Polyclonal Antibody

Sign In for Pricing
View Details
RBM5 Polyclonal Antibody
E-AB-15336-03 120 µL

RBM5 Polyclonal Antibody

Sign In for Pricing
View Details
RBM5 Polyclonal Antibody
E-AB-15336-04 200 µL

RBM5 Polyclonal Antibody

Sign In for Pricing
View Details