Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARMC1 Peptide - C-terminal region

ARMC1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Arcp

UniProt

Q9NVT9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARMC1 Rabbit Polyclonal Antibody (orb588031) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060590

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VEQNTELPDYLPEDESPTKEQDKAVSRVGSHPEGGASWLSTAANFLSRSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZIC1 (Zic Family Member 1 (odd-Paired Homolog, Drosophila), ZIC, ZNF201) (FITC)
MBS6176602-01 0.1 mL

ZIC1 (Zic Family Member 1 (odd-Paired Homolog, Drosophila), ZIC, ZNF201) (FITC)

Sign In for Pricing
View Details
ZIC1 (Zic Family Member 1 (odd-Paired Homolog, Drosophila), ZIC, ZNF201) (FITC)
MBS6176602-02 5x 0.1 mL

ZIC1 (Zic Family Member 1 (odd-Paired Homolog, Drosophila), ZIC, ZNF201) (FITC)

Sign In for Pricing
View Details
Gastrin (PT0139) Antibody (Ready to Use)
N1784R-01 3 mL

Gastrin (PT0139) Antibody (Ready to Use)

Sign In for Pricing
View Details
Gastrin (PT0139) Antibody (Ready to Use)
N1784R-02 6 mL

Gastrin (PT0139) Antibody (Ready to Use)

Sign In for Pricing
View Details
Gastrin (PT0139) Antibody (Ready to Use)
N1784R-03 10 mL

Gastrin (PT0139) Antibody (Ready to Use)

Sign In for Pricing
View Details
2,3-Dichloroquinoxaline
TRC-D435955-25G 25 g

2,3-Dichloroquinoxaline

Sign In for Pricing
View Details