Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NBN Peptide - middle region

NBN Peptide - middle region

Product Specifications

UniProt

O60934

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TGLKTTTPGPSLSQGVSVDEKLMPSAPVNTTTYVADTESEQADTWDLSER

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human BRINP2 activation kit by CRISPRa
GA111728 1 Kit

Human BRINP2 activation kit by CRISPRa

Sign In for Pricing
View Details
CD32B (FCGR2B) (NM_001190828) Human Over-expression Lysate
LC434147 20 µg

CD32B (FCGR2B) (NM_001190828) Human Over-expression Lysate

Sign In for Pricing
View Details
MMP3 Mouse Monoclonal Antibody [Clone ID: OTI2H6]
CF806869 100 µg

MMP3 Mouse Monoclonal Antibody [Clone ID: OTI2H6]

Sign In for Pricing
View Details
ZNF295 (ZBTB21) (NM_001098403) Human Over-expression Lysate
LC420568 20 µg

ZNF295 (ZBTB21) (NM_001098403) Human Over-expression Lysate

Sign In for Pricing
View Details
BTNL9 Human Gene Knockout Kit (CRISPR)
KN420296 1 Kit

BTNL9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS708532 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details