Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NBN Peptide - middle region

NBN Peptide - middle region

Product Specifications

UniProt

O60934

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TGLKTTTPGPSLSQGVSVDEKLMPSAPVNTTTYVADTESEQADTWDLSER

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF706 (NM_001042511) Human Over-expression Lysate
LC420951 20 µg

ZNF706 (NM_001042511) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Mutarotase (GALM) activation kit by CRISPRa
GA115121 1 Kit

Human Mutarotase (GALM) activation kit by CRISPRa

Sign In for Pricing
View Details
1,2-Phenylenediamine
TRC-P319840-500MG 500 mg

1,2-Phenylenediamine

Sign In for Pricing
View Details
Mouse Tlcd1 activation kit by CRISPRa
GA207798 1 Kit

Mouse Tlcd1 activation kit by CRISPRa

Sign In for Pricing
View Details
WASP (WAS) Human Gene Knockout Kit (CRISPR)
KN203457 1 Kit

WASP (WAS) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometriotic tissue
CS711054 5x 5 µm

Tissue FFPE Sections, Endometriotic tissue

Sign In for Pricing
View Details