Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CADM4 Peptide - middle region

CADM4 Peptide - middle region

Product Specifications

Product Name Alternative

IGSF4C, NECL4, Necl-4, TSLL2, synCAM4

UniProt

Q8NFZ8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CADM4 Rabbit Polyclonal Antibody (orb331349) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_660339

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LRWYRDRKELKGVSSSQENGKVWSVASTVRFRVDRKDDGGIIICEAQNQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N4BP2L2 Mouse Monoclonal Antibody [Clone ID: OTI7F5]
CF804202 100 µg

N4BP2L2 Mouse Monoclonal Antibody [Clone ID: OTI7F5]

Sign In for Pricing
View Details
Anti-MX1 Antibody Picoband® PE Conjugated
A00849-3-PE 100 µg/Vial

Anti-MX1 Antibody Picoband® PE Conjugated

Sign In for Pricing
View Details
CYP2J2 (h2) : 293T Lysate
sc-174594 100 µg - 200 µL

CYP2J2 (h2) : 293T Lysate

Sign In for Pricing
View Details
Recombinant Human A1ACT Protein (aa 235-394) [His] [GST]
VAng-2969Lsx-1mg 1 mg

Recombinant Human A1ACT Protein (aa 235-394) [His] [GST]

Sign In for Pricing
View Details
C17orf58 Protein Vector (Human) (pPM-C-His)
PV049624 500 ng

C17orf58 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
SPATA25 CRISPR Activation Plasmid (h2)
sc-414332-ACT-2 20 µg

SPATA25 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details