Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CADM4 Peptide - middle region

CADM4 Peptide - middle region

Product Specifications

Product Name Alternative

IGSF4C, NECL4, Necl-4, TSLL2, synCAM4

UniProt

Q8NFZ8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CADM4 Rabbit Polyclonal Antibody (orb331349) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_660339

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LRWYRDRKELKGVSSSQENGKVWSVASTVRFRVDRKDDGGIIICEAQNQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycoplasma Pneumoniae MPNE_0244 Protein (aa 1-135)
VAng-Lsx05097-50gEcoli 50 µg (E. coli)

Recombinant Mycoplasma Pneumoniae MPNE_0244 Protein (aa 1-135)

Sign In for Pricing
View Details
Mouse Bladder Cancer Antigen BLCA4 ELISA kit
GTR10374552 96 Well

Mouse Bladder Cancer Antigen BLCA4 ELISA kit

Sign In for Pricing
View Details
Human hsa-miR-593-5p miRNA Antagomir
abx885615-01 10 nmol

Human hsa-miR-593-5p miRNA Antagomir

Sign In for Pricing
View Details
Human hsa-miR-593-5p miRNA Antagomir
abx885615-02 20 nmol

Human hsa-miR-593-5p miRNA Antagomir

Sign In for Pricing
View Details
2-Hydroxyestradiol 17-O-b-D-glucuronide
293707-01 1 mg

2-Hydroxyestradiol 17-O-b-D-glucuronide

Sign In for Pricing
View Details
2-Hydroxyestradiol 17-O-b-D-glucuronide
293707-02 2 mg

2-Hydroxyestradiol 17-O-b-D-glucuronide

Sign In for Pricing
View Details