Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUTM2A Peptide - C-terminal region

NUTM2A Peptide - C-terminal region

Product Specifications

UniProt

Q8IVF1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUTM2A Rabbit Polyclonal Antibody (orb326972) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPAEKTPHPGPGLRVSGEQSLTWGLGGPSQSQKRKGDPLVSRKEKKQRCS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3- (Pyrid-2-yloxy) benzaldehyde
288128-01 50 mg

3- (Pyrid-2-yloxy) benzaldehyde

Sign In for Pricing
View Details
3- (Pyrid-2-yloxy) benzaldehyde
288128-02 100 mg

3- (Pyrid-2-yloxy) benzaldehyde

Sign In for Pricing
View Details
3- (Pyrid-2-yloxy) benzaldehyde
288128-03 250 mg

3- (Pyrid-2-yloxy) benzaldehyde

Sign In for Pricing
View Details
3- (Pyrid-2-yloxy) benzaldehyde
288128-04 500 mg

3- (Pyrid-2-yloxy) benzaldehyde

Sign In for Pricing
View Details
3- (Pyrid-2-yloxy) benzaldehyde
288128-05 1 g

3- (Pyrid-2-yloxy) benzaldehyde

Sign In for Pricing
View Details
Rat phosphatidylinositol 4,5 bisphosphate phosphodiesterase β 1 (PLCB1) ELISA kit
GTR10429140 96 Well

Rat phosphatidylinositol 4,5 bisphosphate phosphodiesterase β 1 (PLCB1) ELISA kit

Sign In for Pricing
View Details