Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUTM2A Peptide - C-terminal region

NUTM2A Peptide - C-terminal region

Product Specifications

UniProt

Q8IVF1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUTM2A Rabbit Polyclonal Antibody (orb326972) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPAEKTPHPGPGLRVSGEQSLTWGLGGPSQSQKRKGDPLVSRKEKKQRCS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MED25 Polyclonal Antibody
E-AB-66704-01 60 µL

MED25 Polyclonal Antibody

Sign In for Pricing
View Details
MED25 Polyclonal Antibody
E-AB-66704-02 120 µL

MED25 Polyclonal Antibody

Sign In for Pricing
View Details
MED25 Polyclonal Antibody
E-AB-66704-03 200 µL

MED25 Polyclonal Antibody

Sign In for Pricing
View Details
Thyroxin-BSA conjugate
CSB-MC00471a0105 1 mg

Thyroxin-BSA conjugate

Sign In for Pricing
View Details
TNK1, ID (I332) (CD38 negative kinase 1) (Azide free) (HRP)
MBS6357146-01 0.2 mL

TNK1, ID (I332) (CD38 negative kinase 1) (Azide free) (HRP)

Sign In for Pricing
View Details
TNK1, ID (I332) (CD38 negative kinase 1) (Azide free) (HRP)
MBS6357146-02 5x 0.2 mL

TNK1, ID (I332) (CD38 negative kinase 1) (Azide free) (HRP)

Sign In for Pricing
View Details