Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR3A3 Peptide - C-terminal region

OR3A3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR17-137, OR17-16, OR17-201, OR3A6, OR3A7, OR3A8P

UniProt

P47888

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR3A3 Rabbit Polyclonal Antibody (orb587589) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036505

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MRLGSVESSDKDKGVGVFMTVINPMLNPLIYSLRNTDVQGALCQLLVGKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Oxyntomodulin Elisa Kit
EKC39520 96 Tests

Rat Oxyntomodulin Elisa Kit

Sign In for Pricing
View Details
GPR49 Rabbit Polyclonal Antibody (PE-Cy7)
orb914837 100 µL

GPR49 Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
Goat Triiodothyronine (T3) ELISA Kit
EIA06395Go 1 Kit

Goat Triiodothyronine (T3) ELISA Kit

Sign In for Pricing
View Details
Human Urocortin (UCN) activation kit by CRISPRa
GA105061 1 Kit

Human Urocortin (UCN) activation kit by CRISPRa

Sign In for Pricing
View Details
HSD17B13 Protein Vector (Mouse) (pPM-C-HA)
PV189980 500 ng

HSD17B13 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Actinobacillus pleuropneumoniae serotype 7 Chaperone protein TorD (torD)
MBS1249893-01 0.02 mg (E-Coli)

Recombinant Actinobacillus pleuropneumoniae serotype 7 Chaperone protein TorD (torD)

Sign In for Pricing
View Details