Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR3A3 Peptide - C-terminal region

OR3A3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR17-137, OR17-16, OR17-201, OR3A6, OR3A7, OR3A8P

UniProt

P47888

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR3A3 Rabbit Polyclonal Antibody (orb587589) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036505

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MRLGSVESSDKDKGVGVFMTVINPMLNPLIYSLRNTDVQGALCQLLVGKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACOX1 Rabbit Polyclonal Antibody (Biotin)
orb458404 100 µL

ACOX1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Prdm4 siRNA Oligos set (Rat)
37575176 3x 5 nmol

Prdm4 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
CCL13 rabbit pAb Antibody
orb773139-01 50 μL

CCL13 rabbit pAb Antibody

Sign In for Pricing
View Details
CCL13 rabbit pAb Antibody
orb773139-02 100 µL

CCL13 rabbit pAb Antibody

Sign In for Pricing
View Details
SETD6 3'UTR Luciferase Stable Cell Line
TU022997 1.0 mL

SETD6 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Biotinylated Anti-Canine PD-1 antibody (4E1), Rabbit mAb
MBS1882873-01 0.01 mg

Biotinylated Anti-Canine PD-1 antibody (4E1), Rabbit mAb

Sign In for Pricing
View Details