OR4C45 Peptide - C-terminal region
OR4C45 Peptide - C-terminal region
Product Specifications
UniProt
A6NMZ5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR4C45 Rabbit Polyclonal Antibody (orb327052) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PTSFPTDKAVTVFCTLFTPMLNPLIYTLKNKEVKNVIKKLWKQIMTTDDK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RDR-DYRK1A-Hu-01 96 Tests
Human Dual Specificity Tyrosine Phosphorylation Regulated Kinase 1A (DYRK1A) ELISA Kit
Sign In for Pricing
View Details RDR-DYRK1A-Hu-02 48 Tests
Human Dual Specificity Tyrosine Phosphorylation Regulated Kinase 1A (DYRK1A) ELISA Kit
Sign In for Pricing
View Details 
BNUB1645-100 1x 100 µL
Glypican-3 (GPC3) (Hepatocellular Carcinoma Marker), 0.2mg/mL
Sign In for Pricing
View Details