Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR4C45 Peptide - C-terminal region

OR4C45 Peptide - C-terminal region

Product Specifications

UniProt

A6NMZ5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR4C45 Rabbit Polyclonal Antibody (orb327052) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PTSFPTDKAVTVFCTLFTPMLNPLIYTLKNKEVKNVIKKLWKQIMTTDDK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncoated Human TGF-β1 (Transforming Growth Factor Beta 1) ELISA Kit
E-UNEL-H0169-01 5x 96 Tests

Uncoated Human TGF-β1 (Transforming Growth Factor Beta 1) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human TGF-β1 (Transforming Growth Factor Beta 1) ELISA Kit
E-UNEL-H0169-02 15x 96 Tests

Uncoated Human TGF-β1 (Transforming Growth Factor Beta 1) ELISA Kit

Sign In for Pricing
View Details
Tnk1 Mouse Gene Knockout Kit (CRISPR)
KN518009 1 Kit

Tnk1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Dextrin
TRC-D299608-5G 5 g

Dextrin

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD162 Antibody[4RA10]
E-AB-F1034M-01 50 Tests

Elab Fluor® 647 Anti-Mouse CD162 Antibody[4RA10]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD162 Antibody[4RA10]
E-AB-F1034M-02 100 Tests

Elab Fluor® 647 Anti-Mouse CD162 Antibody[4RA10]

Sign In for Pricing
View Details