Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRSS53 Peptide - C-terminal region

PRSS53 Peptide - C-terminal region

Product Specifications

Product Name Alternative

POL3S, UNQ308

UniProt

Q2L4Q9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRSS53 Rabbit Polyclonal Antibody (orb327095) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001034592

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HSFGDACQGPARPAVFTALPAYEDWVSSLDWQVYFAEEPEPEAEPGSCLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Ethylidene-1,5-dimethyl-3,3-diphenylpyrrolidine-D3 (cis/trans mixture) discontinued
417616-01 2.5 mg

2-Ethylidene-1,5-dimethyl-3,3-diphenylpyrrolidine-D3 (cis/trans mixture) discontinued

Sign In for Pricing
View Details
2-Ethylidene-1,5-dimethyl-3,3-diphenylpyrrolidine-D3 (cis/trans mixture) discontinued
417616-02 25 mg

2-Ethylidene-1,5-dimethyl-3,3-diphenylpyrrolidine-D3 (cis/trans mixture) discontinued

Sign In for Pricing
View Details
rno-miR-190b-3p miRNA Inhibitor
MIR01221 2x 5.0 nmol

rno-miR-190b-3p miRNA Inhibitor

Sign In for Pricing
View Details
Recombinant Human CUB domain-containing protein 1 Protein
ARP5313-01 10 µg

Recombinant Human CUB domain-containing protein 1 Protein

Sign In for Pricing
View Details
Recombinant Human CUB domain-containing protein 1 Protein
ARP5313-02 50 µg

Recombinant Human CUB domain-containing protein 1 Protein

Sign In for Pricing
View Details
Recombinant Human CUB domain-containing protein 1 Protein
ARP5313-03 100 µg

Recombinant Human CUB domain-containing protein 1 Protein

Sign In for Pricing
View Details