PRSS53 Peptide - C-terminal region
PRSS53 Peptide - C-terminal region
Product Specifications
Product Name Alternative
POL3S, UNQ308
UniProt
Q2L4Q9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PRSS53 Rabbit Polyclonal Antibody (orb327095) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001034592
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HSFGDACQGPARPAVFTALPAYEDWVSSLDWQVYFAEEPEPEAEPGSCLA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15108530 1 Vial
Lentiviral mouse Mrm2 shRNA (UAS) - Lentiviral mouse Mrm2 shRNA (UAS, iRFP) (25)
Sign In for Pricing
View Details 
RC214961L3V 200 µL
AGL (NM_000645) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details K1689404 1.0 µg DNA
POTEC sgRNA CRISPR Lentivector (Human) (Target 3)
Sign In for Pricing
View Details 
147415 100 µg
ANXA2, Control Peptide (Annexin A2, Annexin II, Annexin-2, Calpactin I Heavy Chain, Calpactin-1 Heavy Chain, Chromobindin-8, Lipocortin II, Placental Anticoagulant Protein IV, PAP-IV, Protein I, p36, ANX2, ANX2L4, CAL1H, LPC2D)
Sign In for Pricing
View Details