Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMPRSS11A Peptide - C-terminal region

TMPRSS11A Peptide - C-terminal region

Product Specifications

UniProt

Q6ZMR5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMPRSS11A Rabbit Polyclonal Antibody (orb331397) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YDACRGDSGGPLVTRDLKDTWYLIGIVSWGDNCGQKDKPGVYTQVTYYRN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse PP (Pancreatic Polypeptide) ELISA Kit
EK247618 96 Well

Mouse PP (Pancreatic Polypeptide) ELISA Kit

Sign In for Pricing
View Details
Mouse Ehmt2 Pre-designed siRNA Set A
SI104150A 1 Each

Mouse Ehmt2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Human Frizzled Homolog 1 (FZD1) ELISA Kit
DLR-FZD1-Hu-48T 48 Tests

Human Frizzled Homolog 1 (FZD1) ELISA Kit

Sign In for Pricing
View Details
Rat Cdkl1 Pre-designed siRNA Set A
SI202452A 1 Each

Rat Cdkl1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Cntn1 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3717304 1.0 µg DNA

Cntn1 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
6-Chloro-benzofuran-3-one
FC51275-01 1 g

6-Chloro-benzofuran-3-one

Sign In for Pricing
View Details