Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMPRSS11A Peptide - C-terminal region

TMPRSS11A Peptide - C-terminal region

Product Specifications

UniProt

Q6ZMR5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMPRSS11A Rabbit Polyclonal Antibody (orb331397) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YDACRGDSGGPLVTRDLKDTWYLIGIVSWGDNCGQKDKPGVYTQVTYYRN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Klebsiella Pneumoniae lolA Protein (aa 22-203)
VAng-Cr5039-500gEcoli 500 µg (E. coli)

Recombinant Klebsiella Pneumoniae lolA Protein (aa 22-203)

Sign In for Pricing
View Details
Hba-x Protein Vector (Mouse) (pPM-C-HA)
23038024 500 ng

Hba-x Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Di-Lauroyl Peroxide 97%
GPC7412-W 25 g

Di-Lauroyl Peroxide 97%

Sign In for Pricing
View Details
GPT2 (G-7) Alexa Fluor® 647
sc-398383 AF647 200 µg/mL

GPT2 (G-7) Alexa Fluor® 647

Sign In for Pricing
View Details
Anti-MTA2 Monoclonal Antibody, Carrier-free
M03073-carrier-free 100 µL

Anti-MTA2 Monoclonal Antibody, Carrier-free

Sign In for Pricing
View Details
3,3′,5′-Triiodo-L-thyronine
B2010546 10 mg

3,3′,5′-Triiodo-L-thyronine

Sign In for Pricing
View Details