MTMR11 Peptide - N-terminal region
MTMR11 Peptide - N-terminal region
Product Specifications
UniProt
A4FU01
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MGSVQENRMPEPRSRQPSSCLASRCLPGEQILAWAPGVRKGLEPELSGTL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
IDO1-7325HAF647 20 μg- 50 μg- 100 μg
Recombinant Human IDO1 Protein, Gly/Pro-tagged, Alexa Fluor 647 conjugated
Sign In for Pricing
View Details 
AFG-ELL-2236 > 5x 10^5 Cells / Vial
Porcine Type Ii Alveolar Epithelial Cells
Sign In for Pricing
View Details K0465103 1.0 µg DNA
CLIC5 sgRNA CRISPR Lentivector (Human) (Target 2)
Sign In for Pricing
View Details