What is the catalog number for MTMR11 Peptide - N-terminal region?

The catalog number for MTMR11 Peptide - N-terminal region is orb2003284.

What sizes are available for MTMR11 Peptide - N-terminal region?

MTMR11 Peptide - N-terminal region is available in the following size(s): 100 µg.

Is MTMR11 Peptide - N-terminal region in stock?

MTMR11 Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

MTMR11 Peptide - N-terminal region

Product Specifications

UniProt

A4FU01

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MGSVQENRMPEPRSRQPSSCLASRCLPGEQILAWAPGVRKGLEPELSGTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

orb471715 100 µL

DGKB Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing

View Details

299039 50 µg

Total RNA, Tissue, Human Adult Disease, Hypertension, Heart Atrium, Left, BioGenomicsTM

Sign In for Pricing

View Details

OR12165 100 mg

5-Amino-6-bromopyridine-2-carbonitrile

Sign In for Pricing

View Details

NBP3-23620-20ug 20 µg

Mouse Monoclonal ZNF343 Antibody (PCRP-ZNF343-4F8)

Sign In for Pricing

View Details

orb579711 100 µL

BLNK Rabbit Polyclonal Antibody

Sign In for Pricing

View Details

CAU24923-01 100 µL

Interleukin 33 (IL33) Polyclonal Antibody

Sign In for Pricing

View Details