Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SENP7 Peptide - N-terminal region

SENP7 Peptide - N-terminal region

Product Specifications

UniProt

Q9BQF6

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SENP7 Rabbit Polyclonal Antibody (orb331417) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLESYQNLNPHKSCYLSERGSQRSKTVDDNSAKQTAHNKEKRRKDDGISL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Supt3 Mouse Gene Knockout Kit (CRISPR)
KN516990 1 Kit

Supt3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GPD2 Antibody
KC-32921-01 50 μL

GPD2 Antibody

Sign In for Pricing
View Details
GPD2 Antibody
KC-32921-02 100 µL

GPD2 Antibody

Sign In for Pricing
View Details
GPD2 Antibody
KC-32921-03 1 mL

GPD2 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Antibody
AP02023SU-S 20 µL

Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IKZF2 Antibody
KC-7999-01 50 μL

IKZF2 Antibody

Sign In for Pricing
View Details