Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SENP7 Peptide - N-terminal region

SENP7 Peptide - N-terminal region

Product Specifications

UniProt

Q9BQF6

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SENP7 Rabbit Polyclonal Antibody (orb331417) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLESYQNLNPHKSCYLSERGSQRSKTVDDNSAKQTAHNKEKRRKDDGISL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SPLUNC3 (BPIFA3) activation kit by CRISPRa
GA115065 1 Kit

Human SPLUNC3 (BPIFA3) activation kit by CRISPRa

Sign In for Pricing
View Details
Desacetyl Bisacodyl
TRC-D281945-5MG 5 mg

Desacetyl Bisacodyl

Sign In for Pricing
View Details
MCL1 Human Gene Knockout Kit (CRISPR)
KN400521 1 Kit

MCL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Valine Ethyl Ester, Hydrochloride
TRC-V094310-2.5G 2.5 g

Valine Ethyl Ester, Hydrochloride

Sign In for Pricing
View Details
KAT8 Recombinant Rabbit Monoclonal Antibody [JG36-05]
ET7108-23 100 µL

KAT8 Recombinant Rabbit Monoclonal Antibody [JG36-05]

Sign In for Pricing
View Details
Miboplatin
TRC-M342100-50MG 50 mg

Miboplatin

Sign In for Pricing
View Details