SULT1C2 Peptide - N-terminal region
SULT1C2 Peptide - N-terminal region
Product Specifications
UniProt
B4DLP0
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SULT1C2 Rabbit Polyclonal Antibody (orb587971) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_005264069
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DLGKQIKLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Tert-Butyl N-{9-oxo-3-oxabicyclo[3.3.1]nonan-7-yl}carbamate](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
GWC34319-01 50 mg
Tert-Butyl N-{9-oxo-3-oxabicyclo[3.3.1]nonan-7-yl}carbamate
Sign In for Pricing
View Details GWC34319-02 0.5 g
Tert-Butyl N-{9-oxo-3-oxabicyclo[3.3.1]nonan-7-yl}carbamate
Sign In for Pricing
View Details 
MBS641474-01 0.2 mL
CHCH8, CT (CHCHD8, E2IG2, Coiled-coil-helix-coiled-coil-helix domain-containing protein 8, E2-induced gene 2 protein)
Sign In for Pricing
View Details MBS641474-02 5x 0.2 mL
CHCH8, CT (CHCHD8, E2IG2, Coiled-coil-helix-coiled-coil-helix domain-containing protein 8, E2-induced gene 2 protein)
Sign In for Pricing
View Details MBS8520156-02 0.1 mL (AF635)
FoxO4 (phospho Thr451) Polyclonal Antibody
Sign In for Pricing
View Details