Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SULT1C2 Peptide - N-terminal region

SULT1C2 Peptide - N-terminal region

Product Specifications

UniProt

B4DLP0

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SULT1C2 Rabbit Polyclonal Antibody (orb587971) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005264069

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DLGKQIKLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMUB1 Rabbit Polyclonal Antibody (BF750)
orb2391337 100 µL

TMUB1 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Lipoamido-dPEG®4-Acid
DPG-6103-01 100 mg

Lipoamido-dPEG®4-Acid

Sign In for Pricing
View Details
Lipoamido-dPEG®4-Acid
DPG-6103-02 1000 mg

Lipoamido-dPEG®4-Acid

Sign In for Pricing
View Details
N-Debenzoyl-N-[ (3E) -hex-3-enoyl] Paclitaxel
458662-01 1 mg

N-Debenzoyl-N-[ (3E) -hex-3-enoyl] Paclitaxel

Sign In for Pricing
View Details
N-Debenzoyl-N-[ (3E) -hex-3-enoyl] Paclitaxel
458662-02 2.5 mg

N-Debenzoyl-N-[ (3E) -hex-3-enoyl] Paclitaxel

Sign In for Pricing
View Details
Hsa-miR-449c-5p miRNA Antagomir
CIJ0867-01 10 nmol

Hsa-miR-449c-5p miRNA Antagomir

Sign In for Pricing
View Details