Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC22A7 Peptide - N-terminal region

SLC22A7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SLC22A7, NLT, OAT2

UniProt

Q9Y694

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC22A7 Rabbit Polyclonal Antibody (orb578577) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_696961

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MGFEELLEQVGGFGPFQLRNVALLALPRVLLPLHFLLPIFLAAVPAHRCA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR47 Rabbit Polyclonal Antibody
TA370426 100 µL

WDR47 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human TEPSIN activation kit by CRISPRa
GA115571 1 Kit

Human TEPSIN activation kit by CRISPRa

Sign In for Pricing
View Details
NKX1-1 (Center) Rabbit Polyclonal Antibody
AP52889PU-N 400 µL

NKX1-1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SEC62 (NM_003262) Human Recombinant Protein
TP304452L 1 mg

SEC62 (NM_003262) Human Recombinant Protein

Sign In for Pricing
View Details
CD117 (KIT/983), 0.2mg/mL
BNUB0983-500 1x 500 µL

CD117 (KIT/983), 0.2mg/mL

Sign In for Pricing
View Details
HRP-conjugated Flag-Tag Monoclonal Antibody
AN00299HP-01 25 µL

HRP-conjugated Flag-Tag Monoclonal Antibody

Sign In for Pricing
View Details