Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSG8 Peptide - C-terminal region

PSG8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PSG8

UniProt

Q9UQ74

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PSG8 Rabbit Polyclonal Antibody (orb325036) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_874366

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GQKLFIPQITTKHSGLYACSVRNSATGKESSKSMTVKVSGKRIPVSLAIG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE Linked Monoclonal Antibody to Interleukin 18 (IL18)
MBS2127920-01 0.1 mL

PE Linked Monoclonal Antibody to Interleukin 18 (IL18)

Sign In for Pricing
View Details
PE Linked Monoclonal Antibody to Interleukin 18 (IL18)
MBS2127920-02 0.2 mL

PE Linked Monoclonal Antibody to Interleukin 18 (IL18)

Sign In for Pricing
View Details
PE Linked Monoclonal Antibody to Interleukin 18 (IL18)
MBS2127920-03 0.5 mL

PE Linked Monoclonal Antibody to Interleukin 18 (IL18)

Sign In for Pricing
View Details
PE Linked Monoclonal Antibody to Interleukin 18 (IL18)
MBS2127920-04 1 mL

PE Linked Monoclonal Antibody to Interleukin 18 (IL18)

Sign In for Pricing
View Details
PE Linked Monoclonal Antibody to Interleukin 18 (IL18)
MBS2127920-05 5 mL

PE Linked Monoclonal Antibody to Interleukin 18 (IL18)

Sign In for Pricing
View Details
PE Linked Monoclonal Antibody to Interleukin 18 (IL18)
MBS2127920-06 5x 5 mL

PE Linked Monoclonal Antibody to Interleukin 18 (IL18)

Sign In for Pricing
View Details