Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSG8 Peptide - C-terminal region

PSG8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PSG8

UniProt

Q9UQ74

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PSG8 Rabbit Polyclonal Antibody (orb325036) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_874366

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GQKLFIPQITTKHSGLYACSVRNSATGKESSKSMTVKVSGKRIPVSLAIG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZFP30 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
50911111 3x 1.0 µg

ZFP30 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
5,8-Epoxy-13-cis Retinoic Acid (Mixture of Diastereomers)
TRC-E589820-5MG 5 mg

5,8-Epoxy-13-cis Retinoic Acid (Mixture of Diastereomers)

Sign In for Pricing
View Details
ZNF454, NT (ZNF454, Zinc finger protein 454) (MaxLight 750)
MBS6366677-01 0.1 mL

ZNF454, NT (ZNF454, Zinc finger protein 454) (MaxLight 750)

Sign In for Pricing
View Details
ZNF454, NT (ZNF454, Zinc finger protein 454) (MaxLight 750)
MBS6366677-02 5x 0.1 mL

ZNF454, NT (ZNF454, Zinc finger protein 454) (MaxLight 750)

Sign In for Pricing
View Details
ABI1 Protein Vector (Mouse) (pPB-C-His)
PV151326 500 ng

ABI1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
ENT2 (SLC29A2) (NM_001532) Human Over-expression Lysate
LS003177-100ug 100 µg

ENT2 (SLC29A2) (NM_001532) Human Over-expression Lysate

Sign In for Pricing
View Details