Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXO2 Peptide - middle region

FBXO2 Peptide - middle region

Product Specifications

Product Name Alternative

FBXO2, FBX2

UniProt

Q9UK22

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FBXO2 Rabbit Polyclonal Antibody (orb578719) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036300

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HGGDGWRVEELPGDSGVEFTHDESVKKYFASSFEWCRKAQVIDLQAEGYW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCPT1 Protein (C-His, Mouse)
P526713 100 µg

MCPT1 Protein (C-His, Mouse)

Sign In for Pricing
View Details
Recombinant Human Nucleoredoxin-like protein 2
MBS1438647-01 0.02 mg (Baculovirus)

Recombinant Human Nucleoredoxin-like protein 2

Sign In for Pricing
View Details
Recombinant Human Nucleoredoxin-like protein 2
MBS1438647-02 0.1 mg (Baculovirus)

Recombinant Human Nucleoredoxin-like protein 2

Sign In for Pricing
View Details
Recombinant Human Nucleoredoxin-like protein 2
MBS1438647-03 1 mg (Baculovirus)

Recombinant Human Nucleoredoxin-like protein 2

Sign In for Pricing
View Details
Recombinant Human Nucleoredoxin-like protein 2
MBS1438647-04 5x 1 mg (Baculovirus)

Recombinant Human Nucleoredoxin-like protein 2

Sign In for Pricing
View Details
Anti-CDNF Antibody
STJ60052 100 µg

Anti-CDNF Antibody

Sign In for Pricing
View Details