Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXO2 Peptide - middle region

FBXO2 Peptide - middle region

Product Specifications

Product Name Alternative

FBXO2, FBX2

UniProt

Q9UK22

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FBXO2 Rabbit Polyclonal Antibody (orb578719) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036300

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HGGDGWRVEELPGDSGVEFTHDESVKKYFASSFEWCRKAQVIDLQAEGYW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phlda1 3'UTR Lenti-reporter-Luc Vector
36600086 1.0 µg

Phlda1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Poppit Beads red
2100790/2 1 Each

Poppit Beads red

Sign In for Pricing
View Details
anti-BBS1
YF-PA23289 50 ul

anti-BBS1

Sign In for Pricing
View Details
Guinea Pig Ashwin (C2orf49) ELISA Kit
MBS7257406-01 48 Well

Guinea Pig Ashwin (C2orf49) ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Ashwin (C2orf49) ELISA Kit
MBS7257406-02 96 Well

Guinea Pig Ashwin (C2orf49) ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Ashwin (C2orf49) ELISA Kit
MBS7257406-03 5x 96 Well

Guinea Pig Ashwin (C2orf49) ELISA Kit

Sign In for Pricing
View Details