IRF1 Peptide - middle region
IRF1 Peptide - middle region
Product Specifications
Product Name Alternative
IRF1
UniProt
P10914
Field of Research
Infectious Disease & Virology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IRF1 Rabbit Polyclonal Antibody (orb578766) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002189
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNE
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Rat Monoclonal TIM-4 Antibody (1018144) [Alexa Fluor 532]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
FAB2826X 0.1 mL
Rat Monoclonal TIM-4 Antibody (1018144) [Alexa Fluor 532]
Sign In for Pricing
View Details 
134192-PE 100 µL
TAF6 (Transcription Initiation Factor TFIID Subunit 6, RNA Polymerase II TBP-associated Factor Subunit E, Transcription Initiation Factor TFIID 70kD Subunit, TAF (II) 70, TAFII-70, TAFII70, Transcription Initiation Factor TFIID 80kD Subunit, TAF (II) 80, TAFII-80, TAFII80, TAF2E, TAFII70) (PE)
Sign In for Pricing
View Details A07886-1-iFluor647 100 µg
Anti-PLA2G3 Antibody Picoband®, iFluor647 Conjugate
Sign In for Pricing
View Details 25515111 3x 1.0 µg
KIAA0090 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Sign In for Pricing
View Details