Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IRF1 Peptide - middle region

IRF1 Peptide - middle region

Product Specifications

Product Name Alternative

IRF1

UniProt

P10914

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IRF1 Rabbit Polyclonal Antibody (orb578766) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002189

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNE

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL12A Rabbit Polyclonal Antibody (BF350)
orb1592558 100 µL

IL12A Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
4- (1,1-Dioxido-2-isothiazolidinyl) phenylboronic acid pinacol ester
428442-01 25 mg

4- (1,1-Dioxido-2-isothiazolidinyl) phenylboronic acid pinacol ester

Sign In for Pricing
View Details
4- (1,1-Dioxido-2-isothiazolidinyl) phenylboronic acid pinacol ester
428442-02 50 mg

4- (1,1-Dioxido-2-isothiazolidinyl) phenylboronic acid pinacol ester

Sign In for Pricing
View Details
Rose Extract
C14989 25 mg

Rose Extract

Sign In for Pricing
View Details
Phospho-EGFR (Tyr1068) (Clone: E5) rabbit mAb PE conjugate
12-4069-100 100 Tests

Phospho-EGFR (Tyr1068) (Clone: E5) rabbit mAb PE conjugate

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus tRNA-specific 2-thiouridylase mnmA (mnmA)
MBS1025139-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus tRNA-specific 2-thiouridylase mnmA (mnmA)

Sign In for Pricing
View Details