Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM63 Peptide - C-terminal region

TRIM63 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TRIM63, IRF, MURF1, RNF28, SMRZ

UniProt

Q969Q1

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRIM63 Rabbit Polyclonal Antibody (orb578804) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115977

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TIITQLEDSRRVTKENSHQVKEELSQKFDTLYAILDEKKSELLQRITQEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

nexttec Genomic DNA Isolation Kit from Sperm
MBS412794-01 10 Columns

nexttec Genomic DNA Isolation Kit from Sperm

Sign In for Pricing
View Details
nexttec Genomic DNA Isolation Kit from Sperm
MBS412794-02 5x 10 Columns

nexttec Genomic DNA Isolation Kit from Sperm

Sign In for Pricing
View Details
Bovine Cell Division Cycle 23 CDC23 ELISA Kit
BG-BVN10564 1 Each

Bovine Cell Division Cycle 23 CDC23 ELISA Kit

Sign In for Pricing
View Details
CD35 Antibody (Complement Receptor 1)
V9010IHC-7ML 7 mL

CD35 Antibody (Complement Receptor 1)

Sign In for Pricing
View Details
RNY4P5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
40654061 1.0 µg DNA

RNY4P5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human FAF2 qPCR Primer Pair
QH35057S 200 Tests

Human FAF2 qPCR Primer Pair

Sign In for Pricing
View Details