Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR1H4 Peptide - N-terminal region

NR1H4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NR1H4

UniProt

G8JLB0

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NR1H4 Rabbit Polyclonal Antibody (orb579517) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VAGPLGQNLEVEPYSQYSNVQFPQVQPQISSSSYYSNLGFYPQQPEEWYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SCN2B shRNA (UAS) - Lentiviral human SCN2B shRNA (UAS, iRFP) plasmid
GTR15345523 1 Vial

Lentiviral human SCN2B shRNA (UAS) - Lentiviral human SCN2B shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
DDB2 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-61964R-BF555-TR 20 µL

DDB2 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
TWIK-3 discontinued
543472-01 30ul

TWIK-3 discontinued

Sign In for Pricing
View Details
TWIK-3 discontinued
543472-02 100 µL

TWIK-3 discontinued

Sign In for Pricing
View Details
THT-7512-HT-348-YL Specialty Tags for Printers
322625 500 Roll (500 Label x 1 Roll)

THT-7512-HT-348-YL Specialty Tags for Printers

Sign In for Pricing
View Details
MBLAC2 shRNA Plasmid (m)
sc-108869-SH 20 µg

MBLAC2 shRNA Plasmid (m)

Sign In for Pricing
View Details