Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR1H4 Peptide - N-terminal region

NR1H4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NR1H4

UniProt

G8JLB0

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NR1H4 Rabbit Polyclonal Antibody (orb579517) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VAGPLGQNLEVEPYSQYSNVQFPQVQPQISSSSYYSNLGFYPQQPEEWYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Cytokeratin 8 Antibody (SPM538) [DyLight 680]
NBP2-34417FR 0.1 mL

Mouse Monoclonal Cytokeratin 8 Antibody (SPM538) [DyLight 680]

Sign In for Pricing
View Details
USP48 Polyclonal Antibody
E20-74843 100 µg

USP48 Polyclonal Antibody

Sign In for Pricing
View Details
MAN2A2 CRISPR Activation Plasmid (m)
sc-431208-ACT 20 µg

MAN2A2 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
RBMS3 antibody
70R-1317 100 µL

RBMS3 antibody

Sign In for Pricing
View Details
Recombinant Human Rho guanine nucleotide exchange factor 18 (ARHGEF18), partial
CSB-EP744417HU-01 20 µg

Recombinant Human Rho guanine nucleotide exchange factor 18 (ARHGEF18), partial

Sign In for Pricing
View Details
Recombinant Human Rho guanine nucleotide exchange factor 18 (ARHGEF18), partial
CSB-EP744417HU-02 100 µg

Recombinant Human Rho guanine nucleotide exchange factor 18 (ARHGEF18), partial

Sign In for Pricing
View Details