Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF358 Peptide - N-terminal region

ZNF358 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ZNF358

UniProt

Q9NW07

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF358 Rabbit Polyclonal Antibody (orb583800) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005272517

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EDLNTVPEDVDPSYEDLEPVSEDLDPDAEAPGSEPQDPDPMSSSFDLDPD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NLRP3 Recombinant Rabbit monoclonal Antibody
HA723277B 100 µL

Human NLRP3 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
ARRDC1 (NM_152285) Human Recombinant Protein
TP307160 20 µg

ARRDC1 (NM_152285) Human Recombinant Protein

Sign In for Pricing
View Details
CD133 (PROM1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E3]
TA813577BM 100 µL

CD133 (PROM1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E3]

Sign In for Pricing
View Details
Decaglycerin
TRC-D904100-10G 10 g

Decaglycerin

Sign In for Pricing
View Details
Human MTUS2 activation kit by CRISPRa
GA108187 1 Kit

Human MTUS2 activation kit by CRISPRa

Sign In for Pricing
View Details
Human BRCAA1 (ARID4B) activation kit by CRISPRa
GA109970 1 Kit

Human BRCAA1 (ARID4B) activation kit by CRISPRa

Sign In for Pricing
View Details