Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIA2 Peptide - middle region

MIA2 Peptide - middle region

Product Specifications

Product Name Alternative

MEA6, MGEA, TALI, MGEA6, CTAGE5, MGEA11

UniProt

O15320

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MIA2 Rabbit Polyclonal Antibody (orb587346) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKELKEEKSKHSEQDELMADISKRIQSLEDESKSLKSQVAEAKMTFKIFQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRITC Anti-human CD19 Antibody *4G7*
101931J0-AAT 100 Tests

TRITC Anti-human CD19 Antibody *4G7*

Sign In for Pricing
View Details
Rat Tumor necrosis factor soluble receptor Ⅱ,TNFsR-Ⅱ ELISA KIT
CN-01538R1 96T

Rat Tumor necrosis factor soluble receptor Ⅱ,TNFsR-Ⅱ ELISA KIT

Sign In for Pricing
View Details
MRG15 (MORF4L1) (NM_006791) Human Recombinant Protein
TP300251M 100 µg

MRG15 (MORF4L1) (NM_006791) Human Recombinant Protein

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Contactin 2 (CNTN2)
MBS2052508-01 0.1 mL

HRP-Linked Polyclonal Antibody to Contactin 2 (CNTN2)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Contactin 2 (CNTN2)
MBS2052508-02 0.2 mL

HRP-Linked Polyclonal Antibody to Contactin 2 (CNTN2)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Contactin 2 (CNTN2)
MBS2052508-03 0.5 mL

HRP-Linked Polyclonal Antibody to Contactin 2 (CNTN2)

Sign In for Pricing
View Details