Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIA2 Peptide - middle region

MIA2 Peptide - middle region

Product Specifications

Product Name Alternative

MEA6, MGEA, TALI, MGEA6, CTAGE5, MGEA11

UniProt

O15320

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MIA2 Rabbit Polyclonal Antibody (orb587346) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKELKEEKSKHSEQDELMADISKRIQSLEDESKSLKSQVAEAKMTFKIFQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLD4 Rabbit Polyclonal Antibody
TA316060 100 µL

PLD4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
B33-9-461 Pre-sized Labels for Printers
311098 2500 Box (2500 Label (s) x 1 Roll)

B33-9-461 Pre-sized Labels for Printers

Sign In for Pricing
View Details
Human Ras Homolog Gene Family, Member A (RHOA) ELISA Kit
YP-W79883-01 48 Tests

Human Ras Homolog Gene Family, Member A (RHOA) ELISA Kit

Sign In for Pricing
View Details
Human Ras Homolog Gene Family, Member A (RHOA) ELISA Kit
YP-W79883-02 96 Tests

Human Ras Homolog Gene Family, Member A (RHOA) ELISA Kit

Sign In for Pricing
View Details
GOLPH2 (GOLM1) (NM_177937) Human Recombinant Protein
TP721040L 500 µg

GOLPH2 (GOLM1) (NM_177937) Human Recombinant Protein

Sign In for Pricing
View Details
Myotilin (MYOT) Antibody
abx320574-01 20 µL

Myotilin (MYOT) Antibody

Sign In for Pricing
View Details