Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYNC2LI1 Peptide - C-terminal region

DYNC2LI1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DYNC2LI1, D2LIC, LIC3, CGI-60

UniProt

Q8TCX1

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DYNC2LI1 Rabbit Polyclonal Antibody (orb587368) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPMELWKKVYEKLFPPKSINTLKDIKDPARDPQYAENEVDEMRIQKDLEL

More Discoveries

Explore Other Products

Browse additional items from our catalog

HNRPQ (C-Term) Rabbit pAb
MBS8555133-01 0.1 mL

HNRPQ (C-Term) Rabbit pAb

Sign In for Pricing
View Details
HNRPQ (C-Term) Rabbit pAb
MBS8555133-02 0.1 mL (AF405L)

HNRPQ (C-Term) Rabbit pAb

Sign In for Pricing
View Details
HNRPQ (C-Term) Rabbit pAb
MBS8555133-03 0.1 mL (AF405S)

HNRPQ (C-Term) Rabbit pAb

Sign In for Pricing
View Details
HNRPQ (C-Term) Rabbit pAb
MBS8555133-04 0.1 mL (AF610)

HNRPQ (C-Term) Rabbit pAb

Sign In for Pricing
View Details
HNRPQ (C-Term) Rabbit pAb
MBS8555133-05 0.1 mL (AF635)

HNRPQ (C-Term) Rabbit pAb

Sign In for Pricing
View Details
HNRPQ (C-Term) Rabbit pAb
MBS8555133-06 0.1 mL (APC)

HNRPQ (C-Term) Rabbit pAb

Sign In for Pricing
View Details