Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYNC2LI1 Peptide - C-terminal region

DYNC2LI1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DYNC2LI1, D2LIC, LIC3, CGI-60

UniProt

Q8TCX1

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DYNC2LI1 Rabbit Polyclonal Antibody (orb587368) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPMELWKKVYEKLFPPKSINTLKDIKDPARDPQYAENEVDEMRIQKDLEL

More Discoveries

Explore Other Products

Browse additional items from our catalog

Msi2 (m) -PR
sc-75835-PR 10 µM - 20 µL

Msi2 (m) -PR

Sign In for Pricing
View Details
LEQ506 100mg
A20941-100 100 mg

LEQ506 100mg

Sign In for Pricing
View Details
Rat Cytosolic Fe S cluster assembly factor NARFL (NARFL) ELISA kit
GTR10444978 96 Well

Rat Cytosolic Fe S cluster assembly factor NARFL (NARFL) ELISA kit

Sign In for Pricing
View Details
Jak3, phosphorylated (Tyr980/981) (Janus Kinase 3, EC 2.7.10.2, JAKL, Leukocyte Janus Kinase, LJAK)
J0902-06J-01 20 µL

Jak3, phosphorylated (Tyr980/981) (Janus Kinase 3, EC 2.7.10.2, JAKL, Leukocyte Janus Kinase, LJAK)

Sign In for Pricing
View Details
Jak3, phosphorylated (Tyr980/981) (Janus Kinase 3, EC 2.7.10.2, JAKL, Leukocyte Janus Kinase, LJAK)
J0902-06J-02 100 µL

Jak3, phosphorylated (Tyr980/981) (Janus Kinase 3, EC 2.7.10.2, JAKL, Leukocyte Janus Kinase, LJAK)

Sign In for Pricing
View Details
Anti-Spry-2/SPRY2 Antibody Picoband®, PE Conjugate
A02089-2-PE 100 µg/Vial

Anti-Spry-2/SPRY2 Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details