Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT72 Peptide - C-terminal region

KRT72 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KRT72, K6IRS2, KB35, KRT6, KRT6IRS2

UniProt

Q14CN4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRT72 Rabbit Polyclonal Antibody (orb587506) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_542785

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GFSMGFGASSSYSYKTAAADVKTKGSCGSELKDPLAKTSGSSCATKKASR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Kdf1 activation kit by CRISPRa
GA208044 1 Kit

Mouse Kdf1 activation kit by CRISPRa

Sign In for Pricing
View Details
RRAS Rabbit Polyclonal Antibody
TA371490 100 µL

RRAS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human TEX10 activation kit by CRISPRa
GA110338 1 Kit

Human TEX10 activation kit by CRISPRa

Sign In for Pricing
View Details
VSIG8 (NM_001013661) Human Recombinant Protein
TP312118 20 µg

VSIG8 (NM_001013661) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant CD66b Antibody
RC-8444-01 50 μL

Recombinant CD66b Antibody

Sign In for Pricing
View Details
Recombinant CD66b Antibody
RC-8444-02 100 µL

Recombinant CD66b Antibody

Sign In for Pricing
View Details